missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAM8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 589.00€
Specifications
| Antigen | ADAM8 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18665975
|
Novus Biologicals
NBP2-39031-25ul |
25 μL |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18186308
|
Novus Biologicals
NBP2-39031 |
0.1 mL |
589.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ADAM8 Polyclonal specifically detects ADAM8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ADAM8 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P78325 | |
| 101 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QYEVVLPWRLPGPRVRRALPSHLGLHPERVSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Cellular Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| a disintegrin and metalloproteinase domain 8, ADAM 8, ADAM metallopeptidase domain 8, CD156a antigen, CD156human leukocyte differentiation antigen, Cell surface antigen MS2, EC 3.4.24, EC 3.4.24.-, MGC134985, MS2disintegrin and metalloproteinase domain-containing protein 8 | |
| ADAM8 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title