missing translation for 'onlineSavingsMsg'
Learn More

Activin RIB/ALK-4 Antibody, Novus Biologicals™

Product Code. 18101669 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18101669 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18101669 Supplier Novus Biologicals Supplier No. NBP239003

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Activin RIB/ALK-4 Polyclonal specifically detects Activin RIB/ALK-4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Activin RIB/ALK-4
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P36896
Gene Alias activin A receptor, type IB, Activin receptor type IB, Activin receptor-like kinase 4, ACTRIB, ACVRLK4ACTR-IB, ALK-4, ALK4activin A receptor, type II-like kinase 4, EC 2.7.11, EC 2.7.11.30, Serine/threonine-protein kinase receptor R2, SKR2activin receptor type-1B
Gene Symbols ACVR1B
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVEL
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 91
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.