missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Acetylcholinesterase/ACHE Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 529.00€
Specifications
| Antigen | Acetylcholinesterase/ACHE |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18274502
|
Novus Biologicals
NBP2-55516 |
100 μL |
529.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18625766
|
Novus Biologicals
NBP2-55516-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Acetylcholinesterase/ACHE Polyclonal specifically detects Acetylcholinesterase/ACHE in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Acetylcholinesterase/ACHE | |
| Polyclonal | |
| Rabbit | |
| Cellular Markers, Neuronal Cell Markers, Neuroscience, Neurotransmission | |
| acetylcholinesterase, acetylcholinesterase (Yt blood group), AChE, apoptosis-related acetylcholinesterase, ARACHE, EC 3.1.1, EC 3.1.1.7, N-ACHE, YT, Yt blood group | |
| ACHE | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 43 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPNRE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title