missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACAA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
292.00€ - 540.75€
Specifications
| Antigen | ACAA1 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20-1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18464645
|
Novus Biologicals
NBP1-86128 |
0.1 mL |
572.00€ 540.75€ / 0.10mL Save 31.25€ 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18453557
|
Novus Biologicals
NBP1-86128-25ul |
25 μL |
292.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ACAA1 Polyclonal antibody specifically detects ACAA1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| ACAA1 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Proteases & Other Enzymes, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol | |
| 30 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20-1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Acetyl-CoA acyltransferase, acetyl-CoA acyltransferase 1, EC 2.3.1, peroxisomal | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: GNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVA | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title