missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABH2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | ABH2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ABH2 Polyclonal specifically detects ABH2 in Human samples. It is validated for Western Blot.Specifications
| ABH2 | |
| Polyclonal | |
| Rabbit | |
| Q6NS38 | |
| 121642 | |
| Synthetic peptides corresponding to ALKBH2(alkB, alkylation repair homolog 2 (E. coli)) The peptide sequence was selected from the middle region of ABH2 (NP_001001655). Peptide sequence VPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 2OG-Fe(II) oxy DC1, ABH2FLJ99103, alkB, alkylation repair homolog 2 (E. coli), Alkylated DNA repair protein alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase alkB homolog 2, EC 1.14.11.-, MGC90512, Oxy DC1 | |
| ALKBH2 | |
| IgG | |
| 29 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title