missing translation for 'onlineSavingsMsg'
Learn More
Learn More
14-3-3 gamma Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 529.00€
Specifications
| Antigen | 14-3-3 gamma |
|---|---|
| Applications | Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18217850
|
Novus Biologicals
NBP2-54679 |
100 μL |
529.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18669167
|
Novus Biologicals
NBP2-54679-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
14-3-3 gamma Polyclonal specifically detects 14-3-3 gamma in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| 14-3-3 gamma | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cell Cycle and Replication, Cellular Markers, Growth and Development, Neuronal Cell Markers, Neuroscience, Signal Transduction, Stem Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 7532 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:EAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEIS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| 14-3-3 gamma, 14-3-3 protein gamma, 14-3-3GAMMA, KCIP-1, Protein kinase C inhibitor protein 1, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gammapolypeptide | |
| YWHAG | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title