accessibility menu, dialog, popup

UserName

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

brands

  • (1,372)
  • (140,353)
  • (4,566)
  • (14,379)
  • (2)

special programs

  • (1)
  • (11,887)

Applications

  • (30)
  • (106)
  • (16)
  • (9)
  • (2)
  • (170)
  • (44)
  • (4)
  • (896)
  • (431)
  • (113)
  • (12)
  • (39)
  • (3)
  • (16,361)
  • (2)
  • (34)
  • (55)
  • (47)
  • (779)
  • (171)
  • (48,644)
  • (2,023)
  • (1,944)
  • (1,932)
  • (35)
  • (17)
  • (69,764)
  • (233)
  • (2,108)
  • (240)
  • (3,535)
  • (7)
  • (5)
  • (26)
  • (657)
  • (38)
  • (13)
  • (6)
  • (26)
  • (1,162)
  • (405)
  • (23,483)
  • (5,345)
  • (221)
  • (12)
  • (33,086)
  • (52,346)
  • (387)
  • (9,140)
  • (5)
  • (44,597)
  • (22)
  • (3)
  • (347)
  • (7,086)
  • (11)
  • (71)
  • (5)
  • (114)
  • (49)
  • (62)
  • (1,124)
  • (155)
  • (6)
  • (13)
  • (7)
  • (10)
  • (8)
  • (3)
  • (5,733)
  • (6)
  • (207)
  • (18)
  • (1,140)
  • (79)
  • (206)
  • (2)
  • (250)
  • (675)
  • (186)
  • (169)
  • (701)
  • (9)
  • (32)
  • (104)
  • (9)
  • (74,195)
  • (42)
  • (6)

Classification

  • (124,870)
  • (32,765)

Conjugate

  • (3,663)
  • (1,321)
  • (4,298)
  • (4,369)
  • (4,378)
  • (4,158)
  • (4,317)
  • (4,292)
  • (4,333)
  • (4,306)
  • (135)
  • (5,545)
  • (4,680)
  • (1)
  • (2)
  • (4,797)
  • (4,945)
  • (4,881)
  • (9)
  • (4,820)
  • (4,774)
  • (20)
  • (11)
  • (4,892)
  • (4,846)
  • (4,788)
  • (26)
  • (4,676)
  • (210)
  • (4,706)
  • (19)
  • (2,355)
  • (4,516)
  • (1)
  • (1)
  • (4,606)
  • (2,380)
  • (8)
  • (7)
  • (5)
  • (3,257)
  • (5)
  • (1,314)
  • (1,328)
  • (1,315)
  • (3,754)
  • (5)
  • (414)
  • (105)
  • (11)
  • (101)
  • (23,980)
  • (3,255)
  • (3,248)
  • (3,202)

Quantity

  • (1)
  • (1)
  • (100)
  • (382)
  • (529)
  • (1,266)
  • (1)
  • (1)
  • (137)
  • (248)
  • (113,136)
  • (2,891)
  • (1)
  • (566)
  • (31)
  • (1)
  • (1,726)
  • (386)
  • (695)
  • (118)
  • (1)
  • (3,472)
  • (293)
  • (1)
  • (3)
  • (1)
  • (7)
  • (1,074)
  • (774)
  • (68)
  • (1)
  • (57)
  • (2,019)
  • (16,848)
  • (995)
  • (1)
  • (3)
  • (1)
  • (4)
  • (29)
  • (1)
  • (6)
  • (4)
  • (1)
  • (23)
  • (291)
  • (188)
  • (823)
  • (4)
  • (26)
  • (1)
  • (21)
  • (94)
  • (1)
  • (2)
  • (896)
  • (3,362)
  • (369)
  • (6)
  • (10)
  • (5)
  • (2)
  • (96)
  • (6)
  • (66)
  • (1)
  • (1)
  • (1)
  • (3)
  • (1)
  • (7)
  • (158)
  • (1,564)
  • (4)
  • (5)
  • (1)
  • (3)
  • (15)
  • (1,185)
  • (26)
  • (4)
  • (231)

Host Species

  • (566)
  • (14)
  • (288)
  • (593)
  • (6,254)
  • (33)
  • (23)
  • (233)
  • (3,938)
  • (61)
  • (11)
  • (82,479)
  • (17)
  • (48,017)
  • (13,481)
  • (1,314)
  • (1)
  • (1)

Target Species

  • (2)
  • (22)
  • (58)
  • (11)
  • (46)
  • (21)
  • (62)
  • (21)
  • (126)
  • (445)
  • (36)
  • (1,729)
  • (48)
  • (12)
  • (4,358)
  • (123)
  • (54)
  • (81)
  • (61)
  • (2)
  • (1)
  • (3,865)
  • (130)
  • (1,601)
  • (25)
  • (227)
  • (110)
  • (137)
  • (829)
  • (181)
  • (20)
  • (162)
  • (14)
  • (6)
  • (60)
  • (70)
  • (1,273)
  • (54)
  • (1,081)
  • (39)
  • (256)
  • (2)
  • (337)
  • (18)
  • (28)
  • (12)
  • (824)
  • (3)
  • (68)
  • (878)
  • (227)
  • (129)
  • (90)
  • (107)
  • (126)
  • (651)
  • (2)
  • (117,136)
  • (134)
  • (35)
  • (49)
  • (5)
  • (63)
  • (148)
  • (51)
  • (6)
  • (13)
  • (80)
  • (183)
  • (565)
  • (122)
  • (2)
  • (28)
  • (2,241)
  • (56)
  • (1)
  • (42,894)
  • (603)
  • (31)
  • (97)
  • (36)
  • (96)
  • (7)
  • (28)
  • (5)
  • (34)
  • (43)
  • (4,455)
  • (4)
  • (170)
  • (3,404)
  • (23)
  • (35)
  • (2,308)
  • (70)
  • (20,962)
  • (751)
  • (36)
  • (280)
  • (8)
  • (14)
  • (5)
  • (541)
  • (1,792)
  • (1,189)
  • (92)
  • (18)
  • (12)
  • (28)
  • (24)
  • (3)
  • (8,697)
  • (18)
  • (232)
  • (35)
  • (453)

Isotype

  • (59)
  • (29)
  • (1)
  • (15)
  • (49,735)
  • (8,577)
  • (320)
  • (34,174)
  • (20,773)
  • (213)
  • (2)
  • (1,473)
  • (88)
  • (346)
  • (18)
  • (15,407)
  • (5,184)
  • (100)
  • (32)
  • (13,082)
  • (4,558)
  • (331)
  • (1)
  • (86)
  • (239)
  • (559)
  • (247)
  • (569)
  • (148)
  • (29)
  • (291)
  • (153)
  • (75)
  • (9)

Regulatory Status

  • (141,599)

Form

  • (138)
  • (266)
  • (853)
  • (374)
  • (57)
  • (124,147)
  • (6)
  • (2,073)
  • (1)

For Use With (Application)

  • (1)
  • (15)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (1)
1 – 15 of 153,814 results
1

Mouse MMR/CD206 Antibody, R&D Systems™
GREENER_CHOICE

Goat Polyclonal Antibody has been used in 44 publications

2

Human CD163 Antibody, R&D Systems™
GREENER_CHOICE

Goat Polyclonal Antibody has been used in 12 publications

3

Human IL-6 Antibody, R&D Systems™
GREENER_CHOICE

Goat Polyclonal Antibody has been used in 29 publications

4

R&D Systems™ Recombinant Human IL-22 (HEK293-expressed) Protein

Accession Number Q9GZX6.1
Conjugate Unconjugated
Gene Alias Cytokine Zcyto18, IL-10-related T-cell-derived inducible factor, IL22, IL-D110, IL-TIF, ILTIFIL-10-related T-cell-derived-inducible factor, IL-TIFMGC79382, interleukin 22, interleukin-22, MGC79384, TIFa, TIFIL-23, zcyto18
Molecular Weight (g/mol) M.W. Observed: 28-32 kDa, under reducing conditions., M.W. Theoretical: 17 kDa
Gene ID (Entrez) 50616
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
Reconstitution Reconstitute the 10 μg size at 100 μg/mL in PBS. Reconstitute all other sizes at 500 μg/mL in PBS.
For Use With (Application) Bioactivity
Protein IL-22
Source Human embryonic kidney cell, HEK293-derived human IL-22 protein Ala34-Ile179
6

Human Fc gamma RIIB/C (CD32b/c) Biotinylated Antibody, R&D Systems™
GREENER_CHOICE

Mouse Monoclonal Antibody

11

Coagulation Factor III/Tissue Factor Antibody (SN20-16), Novus Biologicals™

Rabbit Monoclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Host Species Rabbit
Conjugate Unconjugated
Form Purified
Isotype IgG
Research Discipline Cancer
Concentration 1 mg/mL
Antigen CoagulationFactorIII/TissueFactor
Gene Symbols F3
Purification Method Protein A purified
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 1:100-1:500, Immunohistochemistry-Paraffin 1:100-1:500
Gene Alias CD142, CD142 antigen, Coagulation factor III, coagulation factor III (thromboplastin, tissue factor), FLJ17960, TF, TFA, Thromboplastin, tissue factor
Gene ID (Entrez) 2152
Formulation TBS (pH7.4), 0.05% BSA, 40% Glycerol with 0.05% Sodium Azide
Immunogen Synthetic peptide within human Coagulation Factor III/Tissue Factor aa 30-70. (SwissProt: P13726 Human; SwissProt: P20352 Mouse; SwissProt: P42533 Rat)
Classification Monoclonal
Primary or Secondary Primary
Clone SN20-16
12

Human IFN-beta Antibody, R&D Systems™
GREENER_CHOICE

Mouse Monoclonal Antibody has been used in 4 publications

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot,Flow Cytometry,Neutralization
Isotype IgG1
Gene Accession No. P01574
Antigen IFN-beta
Gene Symbols IFNB1
Regulatory Status RUO
Purification Method Protein A or G purified from ascites
Dilution Western Blot 1 ug/mL, Flow Cytometry 0.25 uL/10^6 cells, Neutralization 7-21 ug/mL
Gene Alias Fibroblast interferon, IFB, IFBIFNB, IFF, IFNB, IFNB1, IFNbeta, IFN-beta, interferon beta, interferon, beta 1, fibroblast, MGC96956
Gene ID (Entrez) 3456
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen E. coli-derived recombinant human IFN-beta Met22-Asn187 Accession # P01574
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Test Specificity Detects human IFN-beta in Western blots. In Western blots, this antibody does not cross-react with recombinant human IFN-alpha .
Clone 76703
13

IL-6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 5 publications

14

USH1C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Research Discipline Signal Transduction, Vision
Antigen USH1C
Gene Symbols USH1C
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias AIE75, AIE-75, Antigen NY-CO-38/NY-CO-37, Autoimmune enteropathy-related antigen AIE-75, deafness, autosomal recessive 18, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-45, PDZ73, PDZ-73, PDZ-73/NY-CO-38, Protein PDZ-73, Renal carcinoma antigen NY-REN-3, ush1cpst, Usher syndrome 1C (autosomal recessive, severe), Usher syndrome type-1C protein
Gene ID (Entrez) 10083
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IMGKDVRLLRIKKEGSLDLALEGGVDSPIGKVVVSAVYERGAAERHGGIVKGDEIMAINGKIVTDYTLAEAEAALQKAWNQGGDWIDLVVAVCPPKEYDDE
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of human USH1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.