accessibility menu, dialog, popup

UserName

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (6,376)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

centrifuges

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

special offers

  • (138)

brands

  • (1)
  • (6,374)
  • (1)

Applications

  • (3)
  • (9)
  • (10)
  • (2)
  • (30)
  • (54)
  • (4)
Show all

Classification

  • (789)
  • (5,586)

Conjugate

  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
Show all

Host Species

  • (2)
  • (17)
  • (3)
  • (2)
  • (752)
  • (5,594)
  • (5)

Quantity

  • (9)
  • (9)
  • (5)
  • (1)
  • (5)
  • (109)
  • (28)
Show all

Target Species

  • (1)
  • (5)
  • (1)
  • (1)
  • (4,271)
  • (4,217)
  • (5)
Show all

Regulatory Status

  • (6,373)

Isotype

  • (5,555)
  • (30)
  • (497)
  • (3)
  • (2)
  • (2)
  • (127)
Show all

Form

  • (50)
  • (14)
  • (1,441)
1 – 15 of 6,362 results
2

SLC22A10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_001034841
Antigen SLC22A10
Gene Symbols SLC22A10
Regulatory Status RUO
Gene Alias member 10, solute carrier family 22, member 10
Gene ID (Entrez) 387775
Immunogen Synthetic peptide directed towards the middle region of human SLC22A10. Peptide sequence QTLRVALACLGIGCSAATFSSVAVHFIELIPTVLRARASGIDLTASRIGA.
Classification Polyclonal
Primary or Secondary Primary
3

ZNF597 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_689670
Antigen ZNF597
Gene Symbols ZNF597
Regulatory Status RUO
Molecular Weight of Antigen 48 kDa
Gene Alias FLJ33071, zinc finger protein 597
Gene ID (Entrez) 146434
Immunogen Synthetic peptide directed towards the middle region of human ZNF597. Peptide sequence: GLAQHQKSHSAENTYESTNCDKHFNEKPNLALPEETFVSGPQYQHTKCMK
Classification Polyclonal
Primary or Secondary Primary
4

ZNF491 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_689569
Antigen ZNF491
Gene Symbols ZNF491
Regulatory Status RUO
Molecular Weight of Antigen 51 kDa
Gene Alias FLJ34791, MGC126639, zinc finger protein 491
Gene ID (Entrez) 126069
Immunogen Synthetic peptide directed towards the N terminal of human ZNF491. Peptide Sequence: SFNRNIRTDTGHQPHKCQKFLEKPYKHKQRRKALSHSHCFRTHERPHTRE
Classification Polyclonal
Primary or Secondary Primary
5

ZNF680 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_848653
Antigen ZNF680
Gene Symbols ZNF680
Regulatory Status RUO
Molecular Weight of Antigen 62 kDa
Gene Alias FLJ90430, zinc finger protein 680
Gene ID (Entrez) 340252
Immunogen Synthetic peptide directed towards the N terminal of human ZNF680. Peptide sequence: RGYGKCGHENLQLRISCKSVDESKVFKEGYNELNQCLRTTQSKIFQCDKY
Classification Polyclonal
Primary or Secondary Primary
6

ZNF778 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG
Gene Accession No. NP_872337
Antigen ZNF778
Gene Symbols ZNF778
Regulatory Status RUO
Purification Method Protein A purified
Molecular Weight of Antigen 49 kDa
Gene Alias FLJ31875, MGC150573, zinc finger protein 778
Gene ID (Entrez) 197320
Immunogen Synthetic peptide directed towards the middle region of human FLJ31875. Peptide sequence AFTGLSGLSKHVQTDPGQKPYECKDCGKACGGFYLLNEHGKTHTREKPFA.
Classification Polyclonal
Primary or Secondary Primary
7

ZNF879 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Antigen ZNF879
Gene Symbols ZNF879
Regulatory Status RUO
Molecular Weight of Antigen 77 kDa
Gene Alias zinc finger protein 879
Gene ID (Entrez) 345462
Immunogen Synthetic peptide directed towards the N terminal of human DKFZp686E2433. Peptide sequence: MKSGGTNAGGSARETRRLSGAQAQLRPAATGNVSELGVPLASCAVWSCAP
Classification Polyclonal
Primary or Secondary Primary
8

ZNF75A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_694573
Antigen ZNF75A
Gene Symbols ZNF75A
Regulatory Status RUO
Molecular Weight of Antigen 35 kDa
Gene Alias FLJ31529, MGC59959, zinc finger protein 75a
Gene ID (Entrez) 7627
Immunogen Synthetic peptide directed towards the N terminal of human ZNF75A. Peptide sequence FVLPKPKVISCLEQGEEPWVQVSPEFKDSAGKSPTGLKLKNDTENHQPVS.
Classification Polyclonal
Primary or Secondary Primary
9

ZNF619 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Antigen ZNF619
Gene Symbols ZNF619
Regulatory Status RUO
Molecular Weight of Antigen 63 kDa
Gene Alias FLJ90764, zinc finger protein 619
Gene ID (Entrez) 285267
Immunogen Synthetic peptide directed towards the N terminal of human ZNF619. Peptide sequence: RLIVEGLLMDVPQHPDFKDRLEKSQLHDTGNKTKIGDCTDLTVQDHESST
Classification Polyclonal
Primary or Secondary Primary
10

ZNF548 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_690873
Antigen ZNF548
Gene Symbols ZNF548
Regulatory Status RUO
Molecular Weight of Antigen 63 kDa
Gene Alias FLJ32932, zinc finger protein 548
Gene ID (Entrez) 147694
Immunogen Synthetic peptide directed towards the N terminal of human ZNF548. Peptide sequence VHMAEEIFTCMEGWKDLPATSCLLQHQGPQSEWKPYRDTEDREAFQTGQN.
Classification Polyclonal
Primary or Secondary Primary
11

ZNF417 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_689688
Antigen ZNF417
Gene Symbols ZNF417
Regulatory Status RUO
Molecular Weight of Antigen 66 kDa
Gene Alias MGC34079, zinc finger protein 417
Gene ID (Entrez) 147687
Immunogen Synthetic peptide directed towards the N terminal of human ZNF417. Peptide Sequence: HQETHHKQKLNRSGACGKNLDDTAYLHQHQKQHIGEKFYRKSVREASFVK
Classification Polyclonal
Primary or Secondary Primary
12

ZNF670 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG
Gene Accession No. NP_149990
Antigen ZNF670
Gene Symbols ZNF670
Regulatory Status RUO
Purification Method Protein A purified
Molecular Weight of Antigen 45 kDa
Gene Alias FLJ12606, MGC12466, zinc finger protein 670
Gene ID (Entrez) 93474
Immunogen Synthetic peptide directed towards the N terminal of human ZNF670. Peptide sequence EDQNIQDDFKNPGRNLSSHVVERLFEIKEGSQYGETFSQDSNLNLNKKVS.
Classification Polyclonal
Primary or Secondary Primary
13

ZNF570 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_653295
Antigen ZNF570
Gene Symbols ZNF570
Regulatory Status RUO
Molecular Weight of Antigen 62 kDa
Gene Alias zinc finger protein 570
Gene ID (Entrez) 148268
Immunogen Synthetic peptide directed towards the N terminal of human ZNF570. Peptide sequence QGKAPWMVKRELTKGLCSGWEPICETEELTPKQDFYEEHQSQKIIETLTS.
Classification Polyclonal
Primary or Secondary Primary
14

OTUD6A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_997203
Antigen OTUD6A
Gene Symbols OTUD6A
Regulatory Status RUO
Molecular Weight of Antigen 32 kDa
Gene Alias DUBA2, DUBA-2, OTU domain containing 6A
Gene ID (Entrez) 139562
Immunogen Synthetic peptide directed towards the N terminal of human OTUD6A. Peptide sequence MEAEMAQKHRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRER.
Classification Polyclonal
Primary or Secondary Primary
15

SSX5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_783729
Antigen SSX5
Gene Symbols SSX5
Regulatory Status RUO
Molecular Weight of Antigen 22 kDa
Gene Alias MGC9494, protein SSX5, synovial sarcoma, X breakpoint 5
Gene ID (Entrez) 6758
Immunogen The immunogen for this antibody is SSX5 - C-terminal region. Peptide sequence EGNDSKGVPEASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRV.
Classification Polyclonal
Primary or Secondary Primary