missing translation for 'onlineSavingsMsg'
Learn More
Learn More
R&D Systems™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
A Novus product, part of R&D Systems. Applications: Flow Cytometry, In vitro assay
666.75€ - 1464.75€
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18708203
|
R&D Systems™
NBP2-26245 |
1 mg |
 705.00€ 666.75€ / 1mg Save 38.25€ 5% Off |
Estimated Shipment: 13-11-2026
Log in to see stock. |
|||||
|
You must Sign In and have a business account to purchase this item. Restricted Item |
|||||||||
|
18467731
|
R&D Systems™
NBP2-26245-5mg |
5 mg |
1550.00€ 1464.75€ / 5mg Save 85.25€ 5% Off |
Estimated Shipment: 13-11-2026
Log in to see stock. |
|||||
|
You must Sign In and have a business account to purchase this item. Restricted Item |
|||||||||
Description
TLR2 / TLR4 Inhibitor Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKKPGFLRDPWCKYQML (Inhibitor sequence: PGFLRDPWCKYQML); Molecular weight: 4097.92 Da ; Antennapedia Control Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKK; Molecular weight: 2361 Da
For Research Use Only
Spot an opportunity for improvement?
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.