missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ SPINK1 (Human) Recombinant Protein

Human SPINK1 full-length ORF ( NP_003113.2, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00006690-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16123128

  • 545.00€ / 25µg

Estimated Shipment: 07-10-2022
to see stock.
Add to basket

Description

Description

  • Sequence: MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
Specifications

Specifications

NP_003113.2
serine peptidase inhibitor, Kazal type 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SPINK1
GST
6690
Wheat germ expression system
25 μg
PCTT, PSTI, Spink3, TATI
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers