missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ SH2D1A (Human) Recombinant Protein

Name: Abnova&trade; SH2D1A (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16107501
Price: 335.00 EUR

Human SH2D1A full-length ORF ( AAH20732, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00004068-P01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16107501

Quantity

Estimated Shipment: 07-06-2024
to see stock.

Add to basket

Description

Sequence: MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP

Specifications

Accession Number	AAH20732
Name	SH2 domain protein 1A
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	SH2D1A
Protein Tag	GST

Gene ID (Entrez)	4068
Preparation Method	Wheat germ expression system
Quantity	10 μg
Gene Alias	DSHP, EBVS, FLJ18687, FLJ92177, IMD5, LYP, MTCP1, SAP, XLP, XLPD
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description