missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ SFN (Human) Recombinant Protein

Name: Abnova&trade; SFN (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16105641
Price: 335.00 EUR

Human SFN partial ORF ( AAH00329.1, 3 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00002810-Q01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16105641

Quantity

Estimated Shipment: 07-06-2024
to see stock.

Add to basket

Description

Sequence: RASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEE

Specifications

Accession Number	AAH00329.1
Name	stratifin
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	SFN
Protein Tag	GST

Gene ID (Entrez)	2810
Preparation Method	Wheat germ expression system
Quantity	10 μg
Gene Alias	YWHAS
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description