missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PSMB9 (Human) Recombinant Protein

Human PSMB9 full-length ORF ( AAH65513, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00005698-P01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16119801

Quantity
Estimated Shipment: 07-10-2022
to see stock.

Add to basket

Description

Sequence: MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

Specifications

Accession Number	AAH65513
Name	proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2)
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	PSMB9
Protein Tag	GST

Gene ID (Entrez)	5698
Preparation Method	Wheat germ expression system
Quantity	25 μg
Gene Alias	LMP2, MGC70470, PSMB6i, RING12, beta1i
Host Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Description