missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PSMB2 (Human) Recombinant Protein

Human PSMB2 full-length ORF ( AAH00268, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00005690-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16159771

  • 545.00€ / 25µg

Estimated Shipment: 22-08-2022
to see stock.
Add to basket

Description

Description

  • Sequence: MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
Specifications

Specifications

AAH00268
proteasome (prosome, macropain) subunit, beta type, 2
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PSMB2
GST
5690
Wheat germ expression system
25 μg
HC7-I, MGC104215, MGC126885
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers