missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PSMB2 (Human) Recombinant Protein

Name: Abnova&trade; PSMB2 (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16159771
Price: 508.00 EUR

Human PSMB2 full-length ORF ( AAH00268, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00005690-P01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16159771

Quantity

Estimated Shipment: 06-06-2024
to see stock.

Add to basket

Description

Sequence: MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS

Specifications

Accession Number	AAH00268
Name	proteasome (prosome, macropain) subunit, beta type, 2
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	PSMB2
Protein Tag	GST

Gene ID (Entrez)	5690
Preparation Method	Wheat germ expression system
Quantity	25 μg
Gene Alias	HC7-I, MGC104215, MGC126885
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description