missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PSMA3 (Human) Recombinant Protein

Human PSMA3 full-length ORF ( AAH05265, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00005684-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16119761

  • 545.00€ / 25µg

Estimated Shipment: 27-09-2022
to see stock.
Add to basket

Description

Description

  • Sequence: MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM
Specifications

Specifications

AAH05265
proteasome (prosome, macropain) subunit, alpha type, 3
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PSMA3
GST
5684
Wheat germ expression system
25 μg
HC8, MGC12306, MGC32631, PSC3
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers