missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PHB2 Recombinant Protein (P02)

Human PHB2 full-length ORF recombinant protein with GST-tag at N-terminal

Brand:  Abnova™ H00011331-P02.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16156552

  • 359.00€ / 10µg

Estimated Shipment: 19-08-2022
to see stock.
Add to basket

Description

Description

Sequence:
RESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
Best when used within three months from the date of receipt.ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications

Specifications

AAH14766
Solution
11331
PHB2 (Human) Recombinant Protein (P02)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PHB2
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
55
8
Glutathione Sepharose 4 Fast Flow
10 ug
RESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
BAP/BCAP37/Bap37/MGC117268/PNAS-141/REA/p22
PHB2
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers