missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PEX10 (Human) Recombinant Protein

Human PEX10 full-length ORF ( AAH18198.1, 1 a.a. - 326 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00005192-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16158931

  • 545.00€ / 25µg

Estimated Shipment: 24-08-2022
to see stock.
Add to basket

Description

Description

  • Sequence: MAPAAASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVTLHAVLPYLLDKALLPLEQELQADPDSGRPLQGSLGPGGRGCSGARRWMRHHTATLTEQQRRALLRAVFVLRQGLACLQRLHVAWFYIHGVFYHLAKRLTGITYLRVRSLPGEDLRARVSYRLLGVISLLHLVLSMGLQLYGFRQRQRARKEWRLHRGLSHRRASLEERAVSRNPLCTLCLEERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR
Specifications

Specifications

AAH18198.1
peroxisomal biogenesis factor 10
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PEX10
GST
5192
Wheat germ expression system
25 μg
MGC1998, NALD, RNF69
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers