missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NUMB Recombinant Protein

Marque:  Abnova™ H00008650-P01.25ug

Informations supplémentaires : Weight : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16162722

  • 545.00€ / 25µg

Estimated Shipment: 22-08-2022
to see stock.
Ajouter au panier

Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spécification

Spécification

AAH33824
Solution
8650
NUMB (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NUMB
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
40.59
8
Glutathione Sepharose 4 Fast Flow
25 ug
MPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL
S171
NUMB
Wheat Germ (in vitro)
GST
Vidéos
FDS
Documents
Certificats
Promotions

Promotions