missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NR2F6 (Human) Recombinant Protein

Human NR2F6 full-length ORF (BAG37465.1, 1 a.a. - 404 a.a.) recombinant protein with GST tag at N-terminal.

Brand:  Abnova™ H00002063-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16124611

  • 545.00€ / 25µg

Estimated Shipment: 07-10-2022
to see stock.
Add to basket

Description

Description

  • Sequence: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ
Specifications

Specifications

BAG37465.1
nuclear receptor subfamily 2, group F, member 6
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NR2F6
GST
2063
Wheat germ expression system
25 μg
EAR-2, EAR2, ERBAL2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers