missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
A blocking peptide from human MTR. Source: Synthetic Amino Acid Sequence: (Accession #: NP_000245) GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL. The MTR Blocking Peptide is derived from Synthetic. The MTR Blocking Peptide has been validated for the following applications: Antibody Competition.
Specifications
Specifications
| Gene ID (Entrez) | 4548 |
| Species | Human |
| Accession Number | Q99707 |
| Content And Storage | Store at -20 C. Avoid freeze-thaw cycles. |
| Formulation | Lyophilized from sterile distilled water. |
| For Use With (Application) | This Peptide is Useful as a Blocking Peptide for NBP1-79285. This Synthetic Peptide is Designed for Use in an Antibody Competition Assay with Its Corresponding Antibody. Use of This Product in Any Other Assay Has Not Yet Been Tested. For Further Blocking Peptide Related Protocol, Click Here . |
| Gene Alias | 5-methyltetrahydrofolate-homocysteine methyltransferase, 5-methyltetrahydrofolate-homocysteine methyltransferase 1, cblG, cobalamin-dependent methionine synthase, EC 2.1.1.13, FLJ33168, FLJ43216,5-methyltetrahydrofolate--homocysteine methyltransferase, FLJ45386, methionine synthase, MS, Vitamin-B12 dependent methionine synthase |
| Gene Symbol | MTR |
| Molecular Weight (g/mol) | 140kDa |
| Product Type | MTR |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?