missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ MYL6 (Human) Recombinant Protein

Human MYL6 full-length ORF ( NP_066299.2, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00004637-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16158091

  • 545.00€ / 25µg

Estimated Shipment: 24-08-2022
to see stock.
Add to basket

Description

Description

  • Sequence: MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG
Specifications

Specifications

NP_066299.2
myosin, light chain 6, alkali, smooth muscle and non-muscle
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MYL6
GST
4637
Wheat germ expression system
25 μg
ESMLC, LC17-GI, LC17-NM, LC17A, LC17B, MLC1SM, MLC3NM, MLC3SM
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers