missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ MBNL1 (Human) Recombinant Protein

Human MBNL1 full-length ORF ( AAH50535, 1 a.a. - 343 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00004154-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16127641

  • 545.00€ / 25µg

Estimated Shipment: 27-09-2022
to see stock.
Add to basket

Description

Description

  • Sequence: MGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM
Specifications

Specifications

AAH50535
muscleblind-like (Drosophila)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MBNL1
GST
4154
Wheat germ expression system
25 μg
DKFZp686P06174, EXP, EXP35, EXP40, EXP42, KIAA0428, MBNL
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers