missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNF21 Partial ORF (NP_008893, 81 a.a. - 190 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00007569-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16127715

  • 359.00€ / 10µg

Estimated Shipment: 27-09-2022
to see stock.
Add to basket

Description

Description

Sequence: VEECPAEGKIPFWNFPEVCQVDEQIERQHQDDQDKCLLMQVGFSDKKTIITKSARDCHEFGNILHLSTNLVASIQRPDKHESFGNNMVDNLDLFSRSSAENKYDNGCAKL
Specifications

Specifications

NP_008893
Liquid
7569
ZNF21 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HHZ150/KOX14/MGC125383/MGC131713/ZNF21/Zfp182
ZNF182
Yes
wheat germ expression system
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VEECPAEGKIPFWNFPEVCQVDEQIERQHQDDQDKCLLMQVGFSDKKTIITKSARDCHEFGNILHLSTNLVASIQRPDKHESFGNNMVDNLDLFSRSSAENKYDNGCAKL
RUO
ZNF182
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers