missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human UTS2D Full-length ORF (NP_937795.1, 1 a.a. - 119 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00257313-P01.10ug
Additional Details : Weight : 0.00010kg
Description
Sequence: MNKILSSTVCFGLLTLLSVLIFLQSVHGRPYLTQGNEIFPDKKYTNREELLLALLNKNFDFQRPFNTDLALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCVSpecifications
NP_937795.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
40.2kDa | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MGC138371/U2B/URP | |
UTS2D | |
Recombinant | |
wheat germ expression system |
Antibody Production, Protein Array, ELISA, Western Blot | |
257313 | |
UTS2D (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MNKILSSTVCFGLLTLLSVLIFLQSVHGRPYLTQGNEIFPDKKYTNREELLLALLNKNFDFQRPFNTDLALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV | |
RUO | |
UTS2D | |
Wheat Germ (in vitro) | |
GST | |
Liquid |