missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TTC4 Partial ORF (NP_004614.2, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00007268-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
The 34-amino acid tetratricopeptide repeat (TPR) motif is found in a variety of proteins and may mediate protein-protein or protein-membrane interactions.[supplied by OMIM]
Sequence: MEQPGQDPTSDDVMDSFLEKFQSQPYRGGFHEDQWEKEFEKVPLFMTRAPSEIDPRENPDLACLQSIIFDEERSPEEQAKTYKDEGNDYFKEKDYKKAVISpecifications
| NP_004614.2 | |
| Liquid | |
| 7268 | |
| TTC4 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DKFZp781B0622/FLJ41930/MGC5097 | |
| TTC4 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MEQPGQDPTSDDVMDSFLEKFQSQPYRGGFHEDQWEKEFEKVPLFMTRAPSEIDPRENPDLACLQSIIFDEERSPEEQAKTYKDEGNDYFKEKDYKKAVI | |
| RUO | |
| TTC4 | |
| Wheat Germ (in vitro) | |
| GST |