Learn More
Abnova™ Human TNFAIP1 Partial ORF (NP_066960, 258 a.a. - 316 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00007126-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene was identified as a gene whose expression can be induced by the tumor necrosis factor alpha (TNF) in umbilical vein endothelial cells. Studies of a similar gene in mouse suggest that the expression of this gene is developmentally regulated in a tissue-specific manner. [provided by RefSeq]
Sequence: TPRVPDNSLLEATSRSRSQASPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRDSpecifications
| NP_066960 | |
| Liquid | |
| 7126 | |
| TNFAIP1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| B12/B61/EDP1/MGC2317 | |
| TNFAIP1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.23kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| TPRVPDNSLLEATSRSRSQASPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD | |
| RUO | |
| TNFAIP1 | |
| Wheat Germ (in vitro) | |
| GST |