missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TGFA Partial ORF (NP_003227, 42 a.a. - 89 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00007039-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
Transforming growth factors (TGFs) are biologically active polypeptides that reversibly confer the transformed phenotype on cultured cells. TGF-alpha shows about 40% sequence homology with epidermal growth factor (EGF; MIM 131530) and competes with EGF for binding to the EGF receptor (MIM 131550), stimulating its phosphorylation and producing a mitogenic response.[supplied by OMIM]
Sequence: SHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLASpecifications
| NP_003227 | |
| Liquid | |
| 7039 | |
| TGFA (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| TFGA | |
| TGFA | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.02kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| SHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA | |
| RUO | |
| TGFA | |
| Wheat Germ (in vitro) | |
| GST |