Learn More
Abnova™ Human TGFA Partial ORF (NP_003227, 42 a.a. - 89 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00007039-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
Transforming growth factors (TGFs) are biologically active polypeptides that reversibly confer the transformed phenotype on cultured cells. TGF-alpha shows about 40% sequence homology with epidermal growth factor (EGF; MIM 131530) and competes with EGF for binding to the EGF receptor (MIM 131550), stimulating its phosphorylation and producing a mitogenic response.[supplied by OMIM]
Sequence: SHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLASpecifications
NP_003227 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
31.02kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
SHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA | |
RUO | |
TGFA | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
7039 | |
TGFA (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
TFGA | |
TGFA | |
Recombinant | |
wheat germ expression system |