Learn More
Abnova™ Human TBL1XR1 Full-length ORF (ENSP00000314210, 1 a.a. - 102 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00079718-P01.25ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. [provided by RefSeq]
Sequence: MQRYNFHYLKYIVHFYRTCDYSRMIRMVLAYGELLLLTVSAEILFQWTNIVAWQQMPTFCGIAANLQETLVGFSFCFLCFFPLLLNQQGWKEGREVMNYSFQSpecifications
ENSP00000314210 | |
Liquid | |
79718 | |
TBL1XR1 (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MQRYNFHYLKYIVHFYRTCDYSRMIRMVLAYGELLLLTVSAEILFQWTNIVAWQQMPTFCGIAANLQETLVGFSFCFLCFFPLLLNQQGWKEGREVMNYSFQ | |
RUO | |
TBL1XR1 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
38.6kDa | |
Glutathione Sepharose 4 Fast Flow | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
C21/DC42/FLJ12894/IRA1/TBLR1 | |
TBL1XR1 | |
Yes | |
wheat germ expression system |