missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TBL1XR1 Full-length ORF (ENSP00000314210, 1 a.a. - 102 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00079718-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16164393

  • 545.00€ / 25µg

Estimated Shipment: 22-08-2022
to see stock.
Add to basket

Description

Description

The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. [provided by RefSeq]

Sequence: MQRYNFHYLKYIVHFYRTCDYSRMIRMVLAYGELLLLTVSAEILFQWTNIVAWQQMPTFCGIAANLQETLVGFSFCFLCFFPLLLNQQGWKEGREVMNYSFQ
Specifications

Specifications

ENSP00000314210
Liquid
79718
TBL1XR1 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MQRYNFHYLKYIVHFYRTCDYSRMIRMVLAYGELLLLTVSAEILFQWTNIVAWQQMPTFCGIAANLQETLVGFSFCFLCFFPLLLNQQGWKEGREVMNYSFQ
RUO
TBL1XR1
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
38.6kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C21/DC42/FLJ12894/IRA1/TBLR1
TBL1XR1
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers