missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ST18 Partial ORF (NP_055497, 201 a.a. - 300 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

335.00€ - 508.00€

Specifications

Accession Number NP_055497
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 9705
Molecular Weight (g/mol) 36.74kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16101186
View Documents Promotion Details
Abnova™
H00009705-Q01.25UG
25 ug
508.00€
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 28-08-2024
to see stock.
Add to basket
 
16191176
View Documents Promotion Details
Abnova™
H00009705-Q01.10UG
10 ug
335.00€
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 28-08-2024
to see stock.
Add to basket
 
Description

Description

Sequence: NGWDSGSNFSEETKPPRVPKYVLTDHKKDLLEVPEIKTEGDKFIPCENRCDSETERKDPQNALAEPLDGNAQPSFPDVEEEDSESLAVMTEEGSDLEKAK
Specifications

Specifications

NP_055497
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA0535/ZNF387
ST18
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
9705
ST18 (Human) Recombinant Protein (Q01)
NGWDSGSNFSEETKPPRVPKYVLTDHKKDLLEVPEIKTEGDKFIPCENRCDSETERKDPQNALAEPLDGNAQPSFPDVEEEDSESLAVMTEEGSDLEKAK
RUO
ST18
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documents

Documents

Product Certifications