missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SPINK1 Partial ORF (AAH25790, 24 a.a. - 79 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00006690-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis. [provided by RefSeq]
Sequence: DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPCSpecifications
| AAH25790 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.9kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC | |
| RUO | |
| SPINK1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 6690 | |
| SPINK1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PCTT/PSTI/Spink3/TATI | |
| SPINK1 | |
| Recombinant | |
| wheat germ expression system |