missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SOX21 Partial ORF (NP_009015, 224 a.a. - 265 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00011166-Q01.10ug
This item is not returnable.
View return policy
Description
SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are divided into 6 subgroups based on sequence similarity within and outside of the HMG domain. For additional background information on SOX genes, see SOX1 (MIM 602148).[supplied by OMIM]
Sequence: HSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQLSpecifications
| NP_009015 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 30.36kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| HSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQL | |
| RUO | |
| SOX21 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 11166 | |
| SOX21 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| SOX25 | |
| SOX21 | |
| Recombinant | |
| wheat germ expression system |