Learn More
Abnova™ Human SOX21 Partial ORF (NP_009015, 224 a.a. - 265 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00011166-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are divided into 6 subgroups based on sequence similarity within and outside of the HMG domain. For additional background information on SOX genes, see SOX1 (MIM 602148).[supplied by OMIM]
Sequence: HSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQLSpecifications
NP_009015 | |
Liquid | |
11166 | |
SOX21 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
SOX25 | |
SOX21 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
30.36kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
HSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQL | |
RUO | |
SOX21 | |
Wheat Germ (in vitro) | |
GST |