missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC33A1 Partial ORF (NP_004724, 1 a.a. - 69 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00009197-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
The encoded protein is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm. [provided by RefSeq]
Sequence: MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRSpecifications
| NP_004724 | |
| Liquid | |
| 9197 | |
| SLC33A1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ACATN/AT-1/AT1/SPG42 | |
| SLC33A1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.33kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFR | |
| RUO | |
| SLC33A1 | |
| Wheat Germ (in vitro) | |
| GST |