Learn More
Abnova™ Human SLC24A1 Partial ORF (NP_004718, 162 a.a. - 268 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00009187-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
SLC24A1 belongs to a family of potassium-dependent sodium/calcium exchangers. Members of this family have 2 large hydrophilic loops and 2 sets of multiple transmembrane-spanning segments (Schnetkamp, 2004 [PubMed 14770312]).[supplied by OMIM]
Sequence: IVKKYTPTPRGEMKSYSPTQVREKVKYTPSPRGRRVGTYVPSTFMTMETSHAITPRTTVKDSDITATYKILETNSLKRIMEETTPTTLKGMFDSTPTFLTHEVEANVSpecifications
NP_004718 | |
Liquid | |
9187 | |
SLC24A1 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
HsT17412/KIAA0702/NCKX/NCKX1/RODX | |
SLC24A1 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.51kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
IVKKYTPTPRGEMKSYSPTQVREKVKYTPSPRGRRVGTYVPSTFMTMETSHAITPRTTVKDSDITATYKILETNSLKRIMEETTPTTLKGMFDSTPTFLTHEVEANV | |
RUO | |
SLC24A1 | |
Wheat Germ (in vitro) | |
GST |