missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC19A3 Partial ORF (NP_079519.1, 191 a.a. - 277 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00080704-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
SLC19A3 is a member of the reduced folate family of micronutrient transporter genes.[supplied by OMIM]
Sequence: PMPKKSMFFHAKPSREIKKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECYSSKRSpecifications
NP_079519.1 | |
Liquid | |
80704 | |
SLC19A3 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
THTR2 | |
SLC19A3 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.31kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
PMPKKSMFFHAKPSREIKKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECYSSKR | |
RUO | |
SLC19A3 | |
Wheat Germ (in vitro) | |
GST |