missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human RCE1 Partial ORF (NP_005124, 133 a.a. - 182 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00009986-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins. [provided by RefSeq]
Sequence: QLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRACSpecifications
| NP_005124 | |
| Liquid | |
| 9986 | |
| RCE1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FACE2/RCE1A/RCE1B | |
| RCE1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.24kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| QLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRAC | |
| RUO | |
| RCE1 | |
| Wheat Germ (in vitro) | |
| GST |