missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PRG1 Partial ORF (NP_002718, 29 a.a. - 94 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00005552-Q01.25ug
This item is not returnable.
View return policy
Description
This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. [provided by RefSeq]
Sequence: PTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSSpecifications
| NP_002718 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| PTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYS | |
| RUO | |
| SRGN | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 5552 | |
| PRG1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ12930/MGC9289/PPG/PRG/PRG1 | |
| SRGN | |
| Recombinant | |
| wheat germ expression system |