missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PREP Partial ORF (NP_002717.3, 611 a.a. - 710 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005550-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16193255

  • 528.00€ / 25µg

Estimated Shipment: 08-11-2023
to see stock.
Add to basket

Description

Description

The protein encoded by this gene is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Prolyl endopeptidases have been reported to be involved in the maturation and degradation of peptide hormones and neuropeptides. [provided by RefSeq]

Sequence: LVKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDWIP
Specifications

Specifications

NP_002717.3
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LVKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDWIP
RUO
PREP
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
5550
PREP (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC16060/PE/PEP
PREP
Recombinant
wheat germ expression system
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers