missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human POLR3D Partial ORF (-, 296 a.a. - 395 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00000661-Q01.25ug
This item is not returnable.
View return policy
Description
This gene complements a temperature-sensitive mutant isolated from the BHK-21 Syrian hamster cell line. It leads to a block in progression through the G1 phase of the cell cycle at nonpermissive temperatures. [provided by RefSeq]
Sequence: GQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHSpecifications
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 661 | |
| POLR3D (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| BN51T/RPC4/RPC53/TSBN51 | |
| POLR3D | |
| Recombinant | |
| wheat germ expression system |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.63kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| GQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDH | |
| RUO | |
| POLR3D | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |