missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PLXNB2 Partial ORF (XP_371474, 1506 a.a. - 1611 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00023654-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16194976

  • 508.00€ / 25µg
Estimated Shipment: 21-08-2024
to see stock.
Add to basket

Description

Description

Members of the B class of plexins, such as PLXNB2 are transmembrane receptors that participate in axon guidance and cell migration in response to semaphorins (Perrot et al. (2002) [PubMed 12183458]).[supplied by OMIM]

Sequence: LTVSVIVQDEGVDAIPVKVLNCDTISQVKEKIIDQVYRGQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILSKVGVSQQPE
Specifications

Specifications

XP_371474
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.4kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LTVSVIVQDEGVDAIPVKVLNCDTISQVKEKIIDQVYRGQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILSKVGVSQQPE
RUO
PLXNB2
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
23654
PLXNB2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA0315/MM1/Nbla00445/PLEXB2/dJ402G11.3
PLXNB2
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers