missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PHLDA3 Full-length ORF (NP_036528.1, 1 a.a. - 127 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human PHLDA3 Full-length ORF (NP_036528.1, 1 a.a. - 127 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: 16127542
Price: 335.00 EUR

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00023612-P01.10ug

Additional Details : Weight : 0.00010kg

View more versions of this product

Product Code. 16127542

335.00€ / 10µg

Quantity

Estimated Shipment: 12-06-2024
to see stock.

Aggiungi al carrello

Descrizione

Sequence: MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS

Specifica

Accession Number	NP_036528.1
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	40.3kDa
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	TIH1
Gene Symbol	PHLDA3
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	23612
Name	PHLDA3 (Human) Recombinant Protein (P01)
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS
Regulatory Status	RUO
Common Name	PHLDA3
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Suggerimenti di prodotto

Abnova™ Human PHLDA3 Full-length ORF (NP_036528.1, 1 a.a. - 127 a.a.) Recombinant Protein with GST-tag at N-terminal

Descrizione

Specifica

Suggerimenti di prodotto

Documenti

Offerte speciali