missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NUCKS1 Full-length ORF (NP_073568.2, 1 a.a. - 243 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00064710-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16193673

  • 528.00€ / 25µg

Estimated Shipment: 31-10-2023
to see stock.
Add to basket

Description

Description

Sequence: MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKKDDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED
Specifications

Specifications

NP_073568.2
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
53.7kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ21480/FLJ32016/FLJ38536/JC7/NUCKS
NUCKS1
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
64710
NUCKS1 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKKDDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED
RUO
NUCKS1
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers