missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human NUCB2 Partial ORF (NP_005004.1, 322 a.a. - 420 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00004925-Q01.10ug
This item is not returnable.
View return policy
Description
Nucleobindin-2 is a calcium-binding EF-hand protein.[supplied by OMIM]
Sequence: TEKKEFLEPDSWETLDQQQFFTEEELKEYENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHISpecifications
NP_005004.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.63kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
TEKKEFLEPDSWETLDQQQFFTEEELKEYENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHI | |
RUO | |
NUCB2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
4925 | |
NUCB2 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
NEFA | |
NUCB2 | |
Recombinant | |
wheat germ expression system |