missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human NRK Partial ORF (NP_940867, 1483 a.a. - 1582 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00203447-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
NRK is a member of the GCK (MIM 138079) subfamily of protein kinases that are involved in activating the JNK pathway (Kanai-Azuma et al., 1999 [PubMed 10559491]).[supplied by OMIM]
Sequence: VEANEQLFKKILEMWKDIPSSIAFECTQRTTGWGQKAIEVRSLQSRVLESELKRRSIKKLRFLCTRGDKLFFTSTLRNHHSRVYFMTLGKLEELQSNYDVSpecifications
| NP_940867 | |
| Liquid | |
| 203447 | |
| NRK (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DKFZp686A17109/FLJ16788/MGC131849/NESK | |
| NRK | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.63kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| VEANEQLFKKILEMWKDIPSSIAFECTQRTTGWGQKAIEVRSLQSRVLESELKRRSIKKLRFLCTRGDKLFFTSTLRNHHSRVYFMTLGKLEELQSNYDV | |
| RUO | |
| NRK | |
| Wheat Germ (in vitro) | |
| GST |