missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NFAM1 Partial ORF (NP_666017.1, 187 a.a. - 269 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00150372-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16122127

  • 359.00€ / 10µg

Estimated Shipment: 06-10-2022
to see stock.
Add to basket

Description

Description

The protein encoded by this gene is a type I membrane receptor that activates cytokine gene promoters such as the IL-13 and TNF-alpha promoters. The encoded protein contains an immunoreceptor tyrosine-based activation motif (ITAM) and is thought to regulate the signaling and development of B-cells. [provided by RefSeq]

Sequence: NKKRMRGPGKDPTRKCPDPRSASSPKQHPSESVYTALQRRETEVYACIENEDGSSPTAKQSPLSQERPHRFEDDGELNLVYEN
Specifications

Specifications

NP_666017.1
Liquid
150372
NFAM1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CNAIP/FLJ40652/bK126B4.4
NFAM1
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.87kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NKKRMRGPGKDPTRKCPDPRSASSPKQHPSESVYTALQRRETEVYACIENEDGSSPTAKQSPLSQERPHRFEDDGELNLVYEN
RUO
NFAM1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers