missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NDUFB5 Partial ORF (NP_002483, 95 a.a. - 189 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004711-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16158221

  • 359.00€ / 10µg

Estimated Shipment: 22-08-2022
to see stock.
Add to basket

Description

Description

The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq]

Sequence: QAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
Specifications

Specifications

NP_002483
Liquid
4711
NDUFB5 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CI-SGDH/DKFZp686N02262/FLJ30597/MGC111204/MGC12314/SGDH
NDUFB5
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.19kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
QAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
RUO
NDUFB5
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers