missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MYPN Partial ORF (NP_115967, 61 a.a. - 170 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00084665-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16160817

  • 545.00€ / 25µg

Estimated Shipment: 22-08-2022
to see stock.
Add to basket

Description

Description

MYPN is a component of the sarcomere that tethers nebulin (MIM 161650) in skeletal muscle and nebulette (MIM 605491) in cardiac muscle to alpha-actinin (see ACTN2; MIM 102573) at the Z lines (Bang et al., 2001 [PubMed 11309420]).[supplied by OMIM]

Sequence: PDLSAFLSQEELDESVNLARLAINYDPLEKADETQARKRLSPDQMKHSPNLSFEPNFCQDNPRSPTSSKESPQEAKRPQYCSETQSKKVFLNKAADFIEELSSLFKSHSS
Specifications

Specifications

NP_115967
Liquid
84665
MYPN (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MYOP
MYPN
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PDLSAFLSQEELDESVNLARLAINYDPLEKADETQARKRLSPDQMKHSPNLSFEPNFCQDNPRSPTSSKESPQEAKRPQYCSETQSKKVFLNKAADFIEELSSLFKSHSS
RUO
MYPN
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers