missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MSH6 Partial ORF (NP_000170, 931 a.a. - 1030 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

335.00€ - 508.00€

Specifications

Accession Number NP_000170
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 2956
Molecular Weight (g/mol) 36.74kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16195851
View Documents Promotion Details
Abnova™
H00002956-Q01.10UG
10 ug
335.00€
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 28-08-2024
to see stock.
Add to basket
 
16105861
View Documents Promotion Details
Abnova™
H00002956-Q01.25UG
25 ug
508.00€
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 28-08-2024
to see stock.
Add to basket
 
Description

Description

This gene encodes a protein similar to the MutS protein. In E. coli, the MutS protein helps in the recognition of mismatched nucleotides, prior to their repair. A highly conserved region of approximately 150 aa, called the Walker-A adenine nucleotide binding motif, exists in MutS homologs. The encoded protein of this gene combines with MSH2 to form a mismatch recognition complex that functions as a bidirectional molecular switch that exchanges ADP and ATP as DNA mismatches are bound and dissociated. Mutations in this gene have been identified in individuals with hereditary nonpolyposis colon cancer (HNPCC) and endometrial cancer. [provided by RefSeq]

Sequence: AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLK
Specifications

Specifications

NP_000170
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GTBP/HNPCC5/HSAP
MSH6
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
2956
MSH6 (Human) Recombinant Protein (Q01)
AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLK
RUO
MSH6
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documents

Documents

Product Certifications