missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MOGAT3 Partial ORF (NP_835470, 59 a.a. - 107 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00346606-Q01.10ug
This item is not returnable.
View return policy
Description
Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA (Cheng et al., 2003 [PubMed 12618427]).[supplied by OMIM]
Sequence: YLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRSpecifications
| NP_835470 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.13kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| YLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDR | |
| RUO | |
| MOGAT3 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 346606 | |
| MOGAT3 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DC7/DGAT2L7/MGAT3/MGC119203/MGC119204 | |
| MOGAT3 | |
| Recombinant | |
| wheat germ expression system |