Learn More
Abnova™ Human MOGAT3 Partial ORF (NP_835470, 59 a.a. - 107 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00346606-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA (Cheng et al., 2003 [PubMed 12618427]).[supplied by OMIM]
Sequence: YLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRSpecifications
NP_835470 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
31.13kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
YLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDR | |
RUO | |
MOGAT3 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
346606 | |
MOGAT3 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DC7/DGAT2L7/MGAT3/MGC119203/MGC119204 | |
MOGAT3 | |
Recombinant | |
wheat germ expression system |